Sermorelin

Sermorelin Peptide (GHRH 1–29) – Growth Hormone Signaling & Endocrine Research

Synthetic Growth Hormone-Releasing Hormone Analogue for GHRH Receptor Biology, Pituitary GH Secretion, cAMP Signaling & IGF-1 Axis Research

Sermorelin, also known as GHRH(1–29)-NH₂ or GRF(1–29)-NH₂, is a synthetic 29-amino-acid peptide corresponding to the biologically active N-terminal region of human growth hormone-releasing hormone (GHRH).

Unlike recombinant human growth hormone, Sermorelin does not directly replace growth hormone. Instead, it interacts with the growth hormone-releasing hormone receptor (GHRHR) on anterior pituitary somatotroph cells, stimulating endogenous growth hormone (GH) secretion when the relevant physiological systems remain responsive.

Sermorelin is particularly relevant to research involving:

• Growth hormone-releasing hormone receptor biology

• Hypothalamic–pituitary signaling

• Growth hormone secretion

• Gs protein and cyclic AMP signaling

• Protein kinase A activation

• GH–IGF-1 axis regulation

• Endocrine feedback mechanisms

• Growth hormone stimulation testing

• Somatotroph cell physiology

• Peptide receptor pharmacology

• Growth hormone deficiency research

• Age-associated endocrine changes

• Peptide stability and analytical characterization

Sermorelin has a documented history in clinical endocrinology, including previously FDA-approved pharmaceutical products used in growth hormone-related indications.

However, historical pharmaceutical approval must not be confused with the regulatory status of research-grade Sermorelin products.

Evidence supporting Sermorelin as a growth hormone secretagogue does not establish its effectiveness for bodybuilding, weight loss, athletic performance or anti-aging treatment.

ICAME Pharmacy Sermorelin is intended strictly for laboratory research and development purposes.

FOR RESEARCH USE ONLY — NOT FOR HUMAN OR VETERINARY USE.

What Is Sermorelin?

Sermorelin is a synthetic analogue of the N-terminal 29 amino acids of human GHRH.

Naturally occurring human GHRH is commonly described as a 44-amino-acid hypothalamic peptide.

The first 29 amino acids contain the region necessary for substantial GHRH receptor activity.

Sermorelin reproduces this N-terminal region and includes a C-terminal amide.

Understanding the Terminology

GHRH

Growth hormone-releasing hormone, an endogenous hypothalamic hormone.

GHRH(1–29)

The first 29 amino acids of GHRH.

Sermorelin

A synthetic, C-terminally amidated GHRH(1–29) peptide.

Sermorelin Acetate

An acetate salt form of Sermorelin used in certain pharmaceutical and research preparations.

Growth Hormone (GH)

A separate 191-amino-acid protein hormone secreted by the anterior pituitary.

These molecules are related through endocrine signaling but are not chemically identical.

Sermorelin Molecular Structure

Sermorelin is a linear peptide containing 29 amino acid residues.

It does not contain a disulfide-linked cyclic structure.

Its C-terminal arginine residue is amidated.

Molecular Characteristics

The molecular formula and molecular weight above refer to the Sermorelin peptide itself.

Acetate salt forms and preparations containing counterions or residual water may have different total material compositions.

Sermorelin Amino Acid Sequence

The complete amino acid sequence is:

Tyr–Ala–Asp–Ala–Ile–Phe–Thr–Asn–Ser–Tyr–Arg–Lys–Val–Leu–Gly–Gln–Leu–Ser–Ala–Arg–Lys–Leu–Leu–Gln–Asp–Ile–Met–Ser–Arg–NH₂

One-Letter Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

Structural Characteristics

29 amino acid residues

Linear peptide backbone

C-terminal amidation

No intramolecular disulfide bridge

Receptor-active N-terminal region

Methionine-containing sequence

Multiple ionizable side chains

The peptide's amino acid composition is important for receptor recognition, enzymatic stability and analytical identification.

What Is Growth Hormone-Releasing Hormone?

Growth hormone-releasing hormone is a peptide hormone synthesized primarily by neurons in the hypothalamus.

It participates in regulation of growth hormone secretion from the anterior pituitary.

GHRH acts through a specific receptor expressed on somatotroph cells.

The physiological system is regulated by several interacting signals.

Major Components

GHRH: Stimulates growth hormone secretion.

Somatostatin: Inhibits growth hormone secretion.

Ghrelin: Can stimulate GH release through a distinct receptor system.

Growth Hormone: Secreted by anterior pituitary somatotrophs.

IGF-1: Produced in multiple tissues, especially the liver, in response to GH and other regulatory influences.

These signals contribute to the pulsatile pattern of physiological GH secretion.

How Does Sermorelin Work?

Sermorelin functions as a GHRH receptor agonist.

Its primary established mechanism involves binding to GHRHR on anterior pituitary somatotroph cells.

GHRHR is a class B G protein-coupled receptor.

Receptor activation promotes intracellular signaling through the stimulatory G protein, Gs.

This activates adenylyl cyclase and increases cyclic AMP production.

Cyclic AMP then activates protein kinase A and other downstream signaling components.

The resulting cellular responses contribute to growth hormone synthesis and secretion.

Sermorelin Mechanism of Action

Sermorelin (GHRH 1–29)

↓

GHRH Receptor (GHRHR)

↓

Gs Protein Activation

↓

Adenylyl Cyclase Activation

↓

Increased Intracellular cAMP

↓

Protein Kinase A (PKA) Signaling

↓

Somatotroph Cellular Responses

↓

Growth Hormone Release

↓

GH Receptor Signaling in Target Tissues

↓

IGF-1 Production and Other GH-Associated Responses

This pathway represents the established biological relationship between GHRH receptor activation and GH secretion.

The magnitude of the response depends on pituitary function and other physiological conditions.

Sermorelin and GHRH Receptor Research

GHRHR is a receptor expressed primarily in anterior pituitary somatotroph cells.

It belongs to the secretin-family class B GPCRs.

Research Areas

Receptor binding

Receptor activation

Gs protein coupling

Adenylyl cyclase activity

cAMP generation

Receptor desensitization

Somatotroph signaling

Structure–activity relationships

Peptide agonist pharmacology

Sermorelin provides a useful reference molecule for investigating GHRHR-mediated signaling.

Sermorelin and cAMP Signaling

Cyclic adenosine monophosphate, or cAMP, is an intracellular second messenger.

It is produced from ATP by adenylyl cyclase.

In somatotroph cells, GHRHR activation increases cAMP signaling.

Principal Pathway

GHRHR → Gs → Adenylyl Cyclase → cAMP → PKA

This pathway influences several processes involved in growth hormone secretion.

Research may investigate:

cAMP accumulation

PKA activity

Transcriptional regulation

Hormone secretory responses

Receptor desensitization

Cellular signaling kinetics

The response is influenced by the biological model and experimental conditions.

Sermorelin and Protein Kinase A

Protein kinase A is an important effector of cAMP signaling.

PKA can phosphorylate multiple intracellular proteins.

In pituitary somatotrophs, this signaling contributes to processes involved in GH synthesis and secretion.

Research Topics

Protein phosphorylation

Secretory signaling

Transcriptional regulation

Calcium-associated responses

Hormone release

Receptor-dependent signaling

However, PKA is a widely expressed signaling protein.

Its activation in a specific experimental system does not imply a uniform effect throughout the body.

Sermorelin and Growth Hormone Secretion

Growth hormone is secreted by somatotroph cells in the anterior pituitary.

Its secretion is normally pulsatile.

Sermorelin can stimulate GH release by activating the GHRH receptor.

This response has been investigated in clinical endocrinology and experimental pharmacology.

Important Research Variables

Pituitary somatotroph function

Age

Endogenous somatostatin activity

Ghrelin-associated signaling

Baseline endocrine state

Metabolic status

Feedback regulation

Experimental sampling conditions

Sermorelin-induced GH release is not necessarily identical across individuals or biological models.

Sermorelin and Pulsatile Growth Hormone Research

GH secretion normally occurs in pulses rather than at a constant rate.

The pattern is regulated by interactions among hypothalamic GHRH, somatostatin and other signals.

Sermorelin has been investigated for its ability to stimulate endogenous GH secretion.

However, stimulating GH release does not guarantee preservation of every aspect of natural physiological pulsatility.

Research Areas

GH pulse amplitude

Secretory timing

Pituitary responsiveness

Endocrine feedback

Hormone sampling patterns

Age-associated secretion changes

These endpoints are relevant to endocrine physiology research.

Sermorelin and the GH–IGF-1 Axis

The growth hormone–insulin-like growth factor 1 axis is a central endocrine signaling system.

GH binds to growth hormone receptors in multiple tissues.

The liver is an important source of circulating IGF-1.

However, IGF-1 is also produced locally in other tissues.

Simplified Endocrine Pathway

Hypothalamic GHRH

↓

Anterior Pituitary

↓

Growth Hormone

↓

GH Receptors in Target Tissues

↓

IGF-1 Production and Other GH-Dependent Effects

↓

Feedback Regulation

Sermorelin acts upstream of GH secretion.

It does not directly replace GH or IGF-1.

Sermorelin and IGF-1 Research

IGF-1 is involved in growth, metabolism and tissue signaling.

Changes in GH secretion can influence circulating IGF-1 concentrations.

Experimental Research Areas

IGF-1 expression

Hepatic GH signaling

Endocrine feedback

Growth-associated pathways

Metabolic regulation

Age-related endocrine changes

Growth hormone deficiency

However, an increase in GH or IGF-1 does not automatically establish a desirable clinical outcome.

The GH–IGF-1 axis has complex physiological effects and requires careful interpretation.

Sermorelin and Growth Hormone Deficiency Research

Growth hormone deficiency can arise from different abnormalities affecting the hypothalamus, pituitary or associated regulatory systems.

Sermorelin has historically been investigated in the diagnosis and treatment of certain forms of GH deficiency.

Diagnostic Research

Sermorelin can stimulate GH release when pituitary somatotroph cells are sufficiently responsive.

This property was used in growth hormone stimulation testing.

Therapeutic Research

Historical clinical studies investigated Sermorelin in selected children with idiopathic growth hormone deficiency.

Some studies reported improvements in growth velocity.

However, responses varied, and the evidence did not establish that Sermorelin was equivalent to recombinant growth hormone for all patients.

Important Distinction

The historical use of an authorized pharmaceutical formulation does not establish the safety or suitability of a modern research-grade Sermorelin product for clinical administration.

Sermorelin and Growth Hormone Stimulation Testing

Growth hormone stimulation testing evaluates the capacity of the endocrine system to release GH in response to specific stimuli.

Sermorelin was historically used as a diagnostic agent in this context.

Its action depends on the presence of responsive pituitary somatotroph cells.

Diagnostic Research Questions

Can the pituitary respond to GHRH receptor activation?

Is GH secretion reduced?

Does the response differ with hypothalamic dysfunction?

How does the response compare with other stimulation tests?

How do physiological factors influence the measured result?

A normal response to Sermorelin does not exclude every possible cause of GH deficiency.

Diagnostic interpretation requires specialist evaluation and appropriate clinical context.

Sermorelin and Pediatric Endocrinology Research

Historical studies examined Sermorelin in children with selected forms of growth hormone deficiency.

Some trials reported increases in growth velocity during treatment.

However, treatment responses varied.

The effects on final adult height were less clearly established.

Research Areas

Growth velocity

GH secretion

IGF-1 concentrations

Bone maturation

Pituitary responsiveness

Longitudinal endocrine outcomes

Comparative GH therapy research

These findings are part of the historical pharmaceutical evidence base.

They should not be used to promote research-grade Sermorelin for pediatric treatment.

Sermorelin and Aging Research

Growth hormone secretion changes across the lifespan.

Age-associated alterations in GH secretion and IGF-1 levels have attracted interest in endocrine aging research.

Sermorelin has been investigated in this context because it stimulates endogenous GH release.

Research Areas

Age-related GH secretion

Pituitary responsiveness

GH pulse characteristics

IGF-1 regulation

Body composition-associated endocrine signaling

Metabolic aging

Hormonal feedback

However, age-related changes in GH secretion do not establish that increasing GH is beneficial for healthy aging.

Sermorelin has not been demonstrated to reverse aging or extend human lifespan.

Sermorelin and Anti-Aging Claims

Sermorelin is sometimes marketed in connection with anti-aging treatments.

Common claims involve:

Improved vitality

Better sleep

Increased muscle mass

Reduced body fat

Enhanced recovery

Improved skin quality

Longevity

However, these claims are not supported by adequate, large-scale controlled clinical evidence for Sermorelin in healthy adults.

The established ability to stimulate GH release is not equivalent to demonstrated anti-aging efficacy.

Sermorelin and Skeletal Muscle Research

Growth hormone and IGF-1 participate in complex aspects of muscle and metabolic physiology.

Sermorelin's relevance to skeletal muscle research is primarily indirect, through its effects on the GH–IGF-1 axis.

Research Topics

Endocrine regulation

GH receptor signaling

IGF-1-associated pathways

Muscle protein metabolism

Body composition

Age-associated muscle changes

Exercise endocrinology

However, there is insufficient high-quality clinical evidence demonstrating that Sermorelin improves muscle strength or increases muscle mass in healthy adults.

Sermorelin and Muscle Hypertrophy Research

Muscle hypertrophy is influenced by mechanical loading, nutrition and multiple hormonal pathways.

GH and IGF-1 signaling are relevant to aspects of tissue biology.

However, increases in circulating GH do not necessarily produce meaningful improvements in muscle size or functional strength.

Sermorelin has not been established as an effective bodybuilding treatment.

Sermorelin and Body Composition Research

Body composition includes fat mass, lean tissue and other physiological compartments.

The GH–IGF-1 axis influences metabolism and tissue physiology.

Sermorelin has been discussed in relation to body composition because of its ability to stimulate GH secretion.

Research Areas

Lean tissue measurements

Fat mass

GH-associated metabolism

IGF-1 regulation

Age-related endocrine changes

Energy balance

However, robust evidence establishing clinically meaningful body composition benefits from Sermorelin in healthy adults is lacking.

Sermorelin and Lipid Metabolism Research

Growth hormone influences lipid metabolism through multiple pathways.

Potential research endpoints include:

Lipolysis-associated signaling

Fatty acid metabolism

Energy utilization

GH receptor activation

Metabolic feedback

However, Sermorelin's effects on human fat loss have not been adequately established in rigorous clinical trials.

It should not be described as a proven weight-loss medicine.

Sermorelin and Glucose Metabolism

The GH–IGF-1 axis interacts with glucose metabolism and insulin signaling.

Growth hormone can influence insulin sensitivity.

Therefore, compounds that stimulate GH secretion may require careful metabolic evaluation.

Research Topics

Glucose regulation

Insulin sensitivity

GH-associated metabolic effects

IGF-1 signaling

Endocrine feedback

Metabolic safety

An increase in GH secretion is not necessarily metabolically beneficial.

Sermorelin and Sleep Research

Growth hormone secretion is associated with sleep physiology.

Large GH secretory pulses frequently occur in relation to slow-wave sleep.

This physiological association has led to interest in GHRH-related research.

Research Questions

How does sleep influence GH secretion?

Does GHRH signaling interact with sleep regulation?

How do sleep stages relate to GH pulses?

Does altered endocrine signaling affect sleep architecture?

However, evidence supporting Sermorelin as an effective treatment for insomnia or sleep disorders is insufficient.

Sermorelin and Bone Research

GH and IGF-1 participate in skeletal growth and bone remodeling.

Research involving Sermorelin may examine upstream endocrine regulation of these pathways.

Research Areas

GH secretion

IGF-1-associated bone signaling

Bone growth physiology

Bone remodeling

Age-associated skeletal changes

Endocrine regulation of bone

However, Sermorelin has not been established as a treatment for osteoporosis or fracture healing.

Sermorelin and Tissue Repair Research

Growth hormone and IGF-1 influence multiple cellular processes relevant to tissue growth and maintenance.

However, tissue repair is regulated by numerous interacting pathways.

Potential research areas include:

Growth-factor signaling

Cell proliferation

Extracellular matrix biology

Endocrine responses to injury

Tissue remodeling

IGF-1-associated cellular activity

These biological relationships do not establish that Sermorelin accelerates injury healing in humans.

Sermorelin and Pituitary Function

The pituitary gland is central to Sermorelin's biological mechanism.

Sermorelin requires functional GHRH receptors and responsive somatotroph cells to produce a GH secretory response.

Important Research Variables

Somatotroph cell number

GHRHR expression

Pituitary signaling capacity

Receptor desensitization

Hypothalamic regulation

Somatostatin activity

Age and disease state

This dependence on pituitary responsiveness distinguishes Sermorelin from direct recombinant GH replacement.

Sermorelin vs. Recombinant Human Growth Hormone

Sermorelin and recombinant human growth hormone are distinct molecules.

Sermorelin is not equivalent to recombinant HGH.

Sermorelin vs. CJC-1295

CJC-1295 is a synthetic GHRH-related peptide analogue.

Depending on the exact molecular form, CJC-1295 may contain modifications intended to alter peptide stability and exposure.

Key Differences

Sermorelin: A 29-amino-acid GHRH analogue corresponding to the active N-terminal sequence.

CJC-1295: A chemically modified GHRH-related peptide.

Some commercial products labeled CJC-1295 may differ in their exact molecular identity.

The terms CJC-1295 with DAC and modified GRF(1–29) should not be treated as interchangeable.

Differences in pharmacokinetics or biological activity must be supported by compound-specific data.

Sermorelin vs. Ipamorelin

Ipamorelin is a synthetic growth hormone secretagogue that acts through the ghrelin receptor system.

Sermorelin acts through the GHRH receptor.

The compounds act through different receptor systems.

Sermorelin and Ipamorelin Combination Research

GHRH receptor agonists and ghrelin receptor agonists can interact at the level of GH secretion.

Experimental research has investigated how different secretagogue pathways influence pituitary hormone release.

However, a plausible interaction between receptor systems does not establish the clinical safety or efficacy of combining Sermorelin with Ipamorelin.

No combination dosing or administration recommendations are provided for research-grade products.

Sermorelin vs. Tesamorelin

Tesamorelin is a modified GHRH analogue.

Unlike Sermorelin, tesamorelin has an FDA-approved pharmaceutical indication for reduction of excess abdominal fat in adults with HIV-associated lipodystrophy.

This authorization applies to specific approved pharmaceutical products and eligible patient populations.

Tesamorelin's approved clinical indication does not establish equivalent benefits for Sermorelin.

Sermorelin vs. GHRP-2 and GHRP-6

GHRP-2 and GHRP-6 are synthetic growth hormone-releasing peptides.

They act primarily through the ghrelin receptor system.

Sermorelin acts through GHRHR.

Research Differences

Sermorelin: GHRH receptor activation.

GHRP-2: Ghrelin receptor-associated GH secretagogue activity.

GHRP-6: Ghrelin receptor-associated GH secretagogue activity.

These compounds are chemically and pharmacologically distinct.

Sermorelin Human Clinical Evidence

Sermorelin has a more established historical clinical research background than many newer research peptides.

Studies have examined its use in growth hormone stimulation testing and selected pediatric endocrine conditions.

Established Findings

Sermorelin can stimulate pituitary GH secretion.

It has been used in growth hormone stimulation testing.

Historical pediatric studies reported improvements in growth velocity in selected patients.

Important Limitations

Clinical responses depend on pituitary function.

Historical studies do not establish effectiveness for all causes of GH deficiency.

Long-term effects on final adult height were incompletely characterized.

Comparative efficacy against recombinant GH was not fully established.

Evidence for anti-aging, bodybuilding and weight loss remains inadequate.

Sermorelin FDA Regulatory History

Sermorelin acetate was previously marketed in the United States under the brand name Geref.

Different Geref products were authorized for growth hormone-related diagnostic and therapeutic indications.

The manufacturer subsequently discontinued the products.

The FDA withdrew the associated approvals in 2009 following discontinuation.

Importantly, in a 2013 Federal Register determination, the FDA concluded that the relevant Geref products had not been withdrawn from sale for reasons of safety or effectiveness.

Why This Matters

Historical FDA approval does not mean that currently marketed research-grade Sermorelin is FDA-approved.

The discontinued pharmaceutical products and modern laboratory materials are not interchangeable.

The FDA's determination concerning the reasons for withdrawal should not be interpreted as proof of safety for unapproved formulations or uses.

Sermorelin Safety Considerations

Sermorelin has a documented history of pharmaceutical research, but its safety profile depends on the formulation, population and intended use.

Historical Adverse Events

Clinical studies of pharmaceutical Sermorelin reported adverse events including:

Transient facial flushing

Injection-site discomfort

Local reactions

Other treatment-associated symptoms

These observations relate to studied pharmaceutical formulations.

They do not establish the safety of research-grade material.

Endocrine Considerations

GH and IGF-1 signaling can influence:

Glucose metabolism

Insulin sensitivity

Fluid regulation

Tissue growth

Endocrine feedback

Additional Research Considerations

Pituitary responsiveness

Uncertain long-term effects outside studied populations

Potential growth-related signaling concerns

Unknown interactions with other compounds

Product purity and identity

Formulation-specific stability

Potential immunogenicity

Inadequate evidence for nonmedical uses

Research-grade Sermorelin should not be used as a substitute for licensed endocrine treatment.

Sermorelin and Cancer-Related Research Considerations

The GH–IGF-1 axis participates in normal cellular growth and survival.

IGF-1-associated signaling has also been investigated in cancer biology.

This does not establish that Sermorelin causes cancer.

However, endocrine compounds that influence growth-related pathways require careful safety assessment.

The absence of adequate long-term data for unapproved applications means that potential risks cannot be confidently excluded.

Sermorelin and Anti-Doping Regulations

The World Anti-Doping Agency prohibits specified peptide hormones, growth factors and related substances.

Growth hormone-releasing factors and their analogues are relevant to anti-doping regulations.

Athletes and sporting organizations should consult the current WADA Prohibited List.

A research-use label does not exempt a substance from applicable anti-doping restrictions.

Sermorelin should not be marketed for athletic performance enhancement.

Sermorelin Peptide Stability

Sermorelin is a 29-amino-acid peptide susceptible to chemical and enzymatic degradation.

Potential degradation pathways include:

Oxidation

Hydrolysis

Deamidation

Proteolytic cleavage

Aggregation

Adsorption to laboratory surfaces

Temperature-associated degradation

pH-dependent instability

Because Sermorelin contains methionine, oxidation-related stability is a relevant analytical consideration.

Product-specific stability testing is necessary to establish validated storage conditions.

Sermorelin Analytical Characterization

Reliable research requires confirmation of peptide identity and purity.

Important Analytical Parameters

Verified amino acid sequence

C-terminal amidation

Molecular identity

Molecular mass

Peptide purity

Peptide content

Counterion composition

Residual reagents

Oxidation products

Deamidation products

Batch-specific documentation

High-Performance Liquid Chromatography

HPLC is commonly used to assess peptide purity and chromatographic impurities.

The analytical method should be suitable for Sermorelin and its relevant degradation products.

A high HPLC purity percentage does not establish pharmaceutical suitability.

Liquid Chromatography–Mass Spectrometry

LC-MS can help verify molecular identity.

For unmodified Sermorelin, the expected molecular mass is approximately 3,357.9 g/mol.

Mass spectrometry can also help investigate oxidation-related modifications and other molecular variants.

Peptide Content Analysis

Peptide content testing helps distinguish the actual amount of Sermorelin from the total mass of a preparation.

This distinction is important for products containing acetate counterions, residual water or other formulation components.

Certificate of Analysis

A batch-specific Certificate of Analysis should contain relevant analytical data.

Important information may include:

• Product name and identity

• Batch number

• Peptide sequence

• Molecular mass

• Purity

• Peptide content

• Counterion information

• Analytical methodology

• Impurity profile

• Stability-related documentation

A COA does not establish clinical efficacy, sterility or regulatory authorization.

Scientific Evidence and Research Limitations

Established Scientific Findings

• Sermorelin is a 29-amino-acid synthetic GHRH analogue.

• It contains the active N-terminal sequence of human GHRH.

• It has a C-terminal amide.

• Its molecular formula is C₁₄₉H₂₄₆N₄₄O₄₂S.

• Its molecular weight is approximately 3,357.9 g/mol.

• It acts through the GHRH receptor.

• GHRHR activation involves Gs–cAMP-associated signaling.

• Sermorelin stimulates GH secretion in responsive pituitary tissue.

• It has a history of clinical endocrine research.

• Historical Geref products received FDA approval.

• Those products were subsequently discontinued.

• The FDA determined that their withdrawal was not for safety or effectiveness reasons.

Important Limitations

• Sermorelin is not equivalent to recombinant HGH.

• Its response depends on pituitary function.

• Clinical evidence does not support all marketed anti-aging claims.

• Reliable muscle-building benefits in healthy adults are not established.

• Weight-loss efficacy is not established.

• Athletic performance enhancement is not clinically validated.

• Long-term safety for unapproved applications is insufficiently characterized.

• Historical pharmaceutical approval does not authorize research-grade products for human use.

• Research-grade products may differ in purity, content and manufacturing standards.

Potential Sermorelin Research Applications

Sermorelin may be relevant to appropriately controlled laboratory investigations involving:

• GHRH receptor pharmacology

• Class B GPCR signaling

• Gs protein activation

• Adenylyl cyclase activity

• cAMP signaling

• Protein kinase A

• Pituitary somatotroph biology

• Growth hormone secretion

• GH pulse regulation

• GH–IGF-1 axis

• Endocrine feedback

• Growth hormone deficiency models

• Growth hormone stimulation research

• Hypothalamic–pituitary interactions

• Somatostatin-associated regulation

• Ghrelin and GHRH pathway comparisons

• Age-associated endocrine physiology

• GH-associated metabolic signaling

• Receptor desensitization

• Peptide structure–activity relationships

• Peptide stability

• Analytical peptide characterization

These are scientific research applications, not established therapeutic benefits of research-grade Sermorelin.

Sermorelin Research Overview

Compound Name: Sermorelin

Alternative Names: GHRH(1–29)-NH₂ / GRF(1–29)-NH₂

Classification: Synthetic GHRH Analogue

Amino Acid Length: 29

One-Letter Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S

Molecular Weight: Approximately 3,357.9 g/mol

CAS Number: 86168-78-7

PubChem CID: 16132413

Primary Receptor: GHRHR

Receptor Family: Class B GPCR

Principal Signaling: Gs–cAMP–PKA

Primary Biological Response: Growth Hormone Release

Historical FDA-Approved Product: Geref

Current US Regulatory Context: Historical approvals withdrawn following product discontinuation

Intended Research Use: Laboratory Research Only

ICAME Pharmacy Product Information

Product Name: Sermorelin

Alternative Name: GHRH(1–29)

Brand: ICAME Pharmacy

Product Category: Research Peptide

Research Classification: Synthetic GHRH Receptor Agonist

Research Areas: Endocrinology / GH Secretion / GHRHR Signaling / GH–IGF-1 Axis

Intended Use: Laboratory Research & Development Only

Product identity and specifications should be verified using batch-specific analytical documentation.

Relevant quality information includes:

• Verified 29-amino-acid sequence

• Confirmation of C-terminal amidation

• Molecular identity

• Peptide purity

• Peptide content

• Counterion composition

• Impurity profile

• Analytical methodology

• Certificate of Analysis (COA)

• Batch or lot identification

• Validated stability and storage conditions

No claims of pharmaceutical quality, sterility, injectable suitability or clinical efficacy should be made without appropriate supporting documentation.

Important Research Use Notice

FOR RESEARCH USE ONLY (RUO)

This ICAME Pharmacy product is intended exclusively for legitimate laboratory, analytical and scientific research purposes.

Not for human or veterinary use. Not for diagnostic, therapeutic, growth hormone replacement, bodybuilding, weight loss, anti-aging, athletic performance enhancement or other clinical purposes. Not for direct administration to humans or animals.

Sermorelin is a synthetic GHRH analogue with established growth hormone secretagogue activity and a history of pharmaceutical research.

However, research-grade Sermorelin is not equivalent to previously approved pharmaceutical formulations.

Historical FDA approval does not establish the clinical suitability of currently marketed research products.

Information presented on this page is intended solely for scientific and educational purposes and does not constitute medical advice, prescribing information, dosage guidance or instructions for human use.

About ICAME Pharmacy

ICAME Pharmacy provides specialized research products for professional laboratory and scientific applications.

Our portfolio focuses on compounds relevant to peptide science, endocrinology, molecular signaling, growth-factor biology and analytical chemistry.

We emphasize accurate product identification, responsible research use, scientific transparency and clear communication of evidence limitations.

For batch-specific analytical documentation and product inquiries, please contact ICAME Pharmacy.

Frequently Asked Questions About Sermorelin

What is Sermorelin?

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the biologically active N-terminal region of human GHRH.

Is Sermorelin the same as GHRH(1–29)?

Sermorelin is the C-terminally amidated form of GHRH(1–29).

How many amino acids does Sermorelin contain?

29 amino acids.

What is the amino acid sequence of Sermorelin?

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂.

What is the molecular formula of Sermorelin?

C₁₄₉H₂₄₆N₄₄O₄₂S.

What is the molecular weight of Sermorelin?

Approximately 3,357.9 g/mol.

What is the CAS number of Sermorelin?

86168-78-7.

What is Sermorelin acetate?

Sermorelin acetate is an acetate salt form of the Sermorelin peptide.

What receptor does Sermorelin activate?

The growth hormone-releasing hormone receptor, GHRHR.

What is Sermorelin's mechanism of action?

Sermorelin activates GHRHR, leading to Gs–adenylyl cyclase–cAMP-associated signaling and stimulation of pituitary GH secretion.

Is Sermorelin growth hormone?

No. Sermorelin stimulates endogenous GH release, while growth hormone itself directly activates GH receptors.

Does Sermorelin increase IGF-1?

Stimulation of GH secretion can influence IGF-1 production, but the response depends on endocrine and physiological factors.

Does Sermorelin work without a functional pituitary?

Its ability to stimulate GH secretion depends on responsive pituitary somatotroph cells.

Has Sermorelin been studied in humans?

Yes. Sermorelin has a documented history of human endocrine research.

Was Sermorelin FDA-approved?

Yes. Specific Sermorelin acetate pharmaceutical products were previously FDA-approved.

Why was Geref discontinued?

The products were commercially discontinued, and the FDA subsequently determined that they were not withdrawn for reasons of safety or effectiveness.

Is Sermorelin currently an FDA-approved marketed product?

The historical Geref approvals were withdrawn. Research-grade Sermorelin is not an FDA-approved human therapeutic product.

Does Sermorelin build muscle?

Adequate clinical evidence does not establish Sermorelin as an effective muscle-building treatment for healthy adults.

Does Sermorelin reduce body fat?

Reliable weight-loss efficacy has not been established for Sermorelin in healthy adults.

Is Sermorelin an anti-aging treatment?

No clinically validated anti-aging or lifespan-extension benefit has been established.

Is Sermorelin the same as CJC-1295?

No. CJC-1295 is a modified GHRH-related analogue.

Is Sermorelin the same as Ipamorelin?

No. Sermorelin acts through GHRHR, while Ipamorelin acts through the ghrelin receptor system.

Is Sermorelin the same as Tesamorelin?

No. Tesamorelin is a distinct modified GHRH analogue with specific approved pharmaceutical applications.

Is Sermorelin safe for human use?

Safety depends on the specific pharmaceutical preparation and clinical context. Research-grade Sermorelin has not been established as suitable for human administration.

Is ICAME Pharmacy Sermorelin intended for human use?

No. ICAME Pharmacy Sermorelin is intended strictly for laboratory research and development purposes.