Tesamorelin

Tesamorelin (TH9507) Research Peptide – GHRH Receptor Signaling, Visceral Fat & GH–IGF-1 Axis Research

Synthetic Growth Hormone-Releasing Hormone Analogue for Pituitary GH Secretion, Visceral Adipose Tissue, Lipid Metabolism & Endocrine Research

Tesamorelin, also known as TH9507, is a synthetic, stabilized analogue of human growth hormone-releasing hormone (GHRH). It is a 44-amino-acid peptide containing an N-terminal trans-3-hexenoyl modification designed to improve stability compared with native GHRH.

Tesamorelin acts as an agonist of the growth hormone-releasing hormone receptor (GHRHR), a G protein-coupled receptor expressed by growth hormone-producing cells in the anterior pituitary gland.

By activating GHRHR, tesamorelin stimulates endogenous growth hormone (GH) secretion and influences the downstream growth hormone–insulin-like growth factor 1 (GH–IGF-1) axis.

Tesamorelin has attracted scientific interest because of its effects on visceral adipose tissue, lipid metabolism, endocrine signaling and metabolic complications associated with HIV-related lipodystrophy.

Unlike many experimental research peptides, tesamorelin is also the active ingredient in FDA-approved prescription medicines, including EGRIFTA SV and EGRIFTA WR, for a specific medical indication.

These approved pharmaceutical formulations are indicated for the reduction of excess abdominal fat in adults with HIV-associated lipodystrophy.

However, tesamorelin is not FDA-approved for general weight management, bodybuilding, anti-aging or athletic performance enhancement.

The regulatory approval of a prescription tesamorelin formulation does not establish the safety, efficacy or pharmaceutical equivalence of research-grade tesamorelin products.

ICAME Pharmacy Tesamorelin is intended exclusively for laboratory research and development purposes.

FOR RESEARCH USE ONLY — NOT FOR HUMAN OR VETERINARY USE.

What Is Tesamorelin?

Tesamorelin is a synthetic peptide analogue of naturally occurring human GHRH.

GHRH is a hypothalamic hormone involved in regulating growth hormone secretion from the anterior pituitary gland.

Tesamorelin retains the 44-amino-acid backbone of human GHRH while incorporating an N-terminal chemical modification.

This modification contributes to the peptide's stability and pharmacological characteristics.

The compound has been investigated in:

• GHRH receptor signaling

• Pituitary growth hormone secretion

• GH–IGF-1 endocrine regulation

• Visceral adipose tissue metabolism

• HIV-associated lipodystrophy

• Lipid metabolism

• Hepatic fat accumulation

• Insulin sensitivity

• Body composition

• Metabolic inflammation

• Endocrine feedback regulation

• Peptide stability and pharmacokinetics

Its most extensively characterized clinical application involves excess abdominal fat associated with HIV-related lipodystrophy.

Tesamorelin Molecular Structure and Chemical Properties

Tesamorelin is a modified 44-amino-acid peptide.

It is structurally related to human GHRH(1–44).

The peptide contains a trans-3-hexenoyl modification at the N-terminus and a C-terminal amide.

Molecular Characteristics

The molecular formula and weight above describe the tesamorelin molecular entity.

The chemical composition of tesamorelin acetate and other formulated preparations can differ because of counterions and other components.

Tesamorelin Amino Acid Sequence

Tesamorelin contains 44 amino acid residues.

Its amino acid backbone corresponds to human GHRH(1–44).

One-Letter Amino Acid Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

The complete tesamorelin molecular identity also includes:

N-terminal trans-3-hexenoyl modification

C-terminal amidation

These features must be considered when identifying the compound analytically.

Why Is the N-Terminal Modification Important?

Naturally occurring GHRH is susceptible to enzymatic degradation.

Tesamorelin's N-terminal modification was developed to improve its stability.

The modification also distinguishes tesamorelin chemically from native GHRH.

Why Is C-Terminal Amidation Important?

C-terminal amidation affects peptide charge and molecular identity.

It can also influence peptide stability and molecular interactions.

The modified tesamorelin molecule should not be confused with an unmodified GHRH peptide having the same amino acid backbone.

What Is Growth Hormone-Releasing Hormone?

Growth hormone-releasing hormone is a peptide hormone produced primarily by neurons in the hypothalamus.

It regulates growth hormone secretion from the anterior pituitary gland.

GHRH acts on specialized pituitary cells known as somatotrophs.

Physiological GHRH Pathway

Hypothalamus

↓

Growth Hormone-Releasing Hormone

↓

Anterior Pituitary GHRH Receptor

↓

Growth Hormone Secretion

↓

Growth Hormone Receptors in Target Tissues

↓

IGF-1 Production and Metabolic Signaling

The pathway is regulated by several feedback mechanisms.

Somatostatin, ghrelin-related signaling, circulating GH and IGF-1 all influence the broader endocrine environment.

How Does Tesamorelin Work?

Tesamorelin binds to and activates the GHRH receptor on anterior pituitary somatotroph cells.

GHRHR is a class B G protein-coupled receptor.

Its activation is associated primarily with stimulatory G protein signaling.

Tesamorelin Mechanism of Action

Tesamorelin (TH9507)

↓

GHRH Receptor Activation (GHRHR)

↓

Gs Protein Activation

↓

Adenylyl Cyclase Stimulation

↓

Increased Intracellular cAMP

↓

Protein Kinase A (PKA) Signaling

↓

Growth Hormone Synthesis and Secretion

↓

GH Receptor Activation

↓

IGF-1 Production and Metabolic Effects

This pathway provides the basis for investigating tesamorelin in endocrine and metabolic research.

Important Mechanistic Distinction

Tesamorelin does not directly replace growth hormone.

Instead, it stimulates endogenous GH secretion through the pituitary GHRH receptor.

The response depends on functional pituitary somatotroph cells and an intact endocrine signaling pathway.

Tesamorelin and GHRH Receptor Research

The GHRH receptor plays a central role in pituitary growth hormone regulation.

Tesamorelin is relevant to investigations of receptor activation and downstream signaling.

Research Areas

GHRHR binding

Receptor activation potency

Gs protein coupling

Adenylyl cyclase activity

cAMP accumulation

PKA signaling

Somatotroph responses

GH secretion

Receptor desensitization

Endocrine feedback

Researchers may compare tesamorelin with native GHRH and other synthetic GHRH analogues to evaluate differences in receptor pharmacology.

Tesamorelin and cAMP Signaling

Cyclic adenosine monophosphate is an intracellular second messenger.

GHRHR activation stimulates adenylyl cyclase through Gs-associated signaling.

This increases intracellular cAMP.

cAMP activates downstream pathways involved in somatotroph function.

Experimental Endpoints

Intracellular cAMP

PKA activation

Transcriptional responses

GH secretion

Receptor sensitivity

Receptor internalization

Signal duration

Feedback regulation

These measurements are useful in laboratory studies of GHRH receptor pharmacology.

Tesamorelin and Growth Hormone Secretion

Growth hormone is secreted by the anterior pituitary gland.

Its release is regulated by hypothalamic and peripheral signals.

Tesamorelin stimulates endogenous GH secretion by activating GHRHR.

Research Areas

GH secretory responses

Pituitary somatotroph physiology

GH pulse dynamics

Endocrine feedback

Age-associated GH regulation

Metabolic effects of GH

IGF-1 responses

Although tesamorelin stimulates GH secretion, this does not mean it produces the same pharmacological profile as recombinant human growth hormone.

Tesamorelin and the GH–IGF-1 Axis

The GH–IGF-1 axis is involved in growth, metabolism and tissue physiology.

Growth hormone stimulates IGF-1 production, particularly in the liver.

IGF-1 participates in several biological processes.

Research Areas

IGF-1 production

GH receptor signaling

Metabolic regulation

Protein metabolism

Lipid metabolism

Endocrine feedback

Tissue responses

Tesamorelin can increase circulating IGF-1 concentrations.

This is relevant to both its pharmacodynamic effects and its safety monitoring.

Elevated IGF-1 is not automatically beneficial.

Sustained increases require clinical consideration because of potential risks.

Tesamorelin and Visceral Adipose Tissue Research

Visceral adipose tissue is fat located within the abdominal cavity around internal organs.

It differs biologically from subcutaneous adipose tissue.

Excess visceral adiposity is associated with metabolic risk factors.

Tesamorelin has been investigated extensively for its effects on visceral fat in adults with HIV-associated lipodystrophy.

Research Endpoints

Visceral adipose tissue area

Abdominal fat distribution

Waist circumference

Trunk fat measurements

Body composition

Metabolic biomarkers

IGF-1 concentrations

Clinical studies have demonstrated reductions in visceral adipose tissue in the approved patient population.

However, tesamorelin is not a general weight-loss medicine.

Tesamorelin and HIV-Associated Lipodystrophy

HIV-associated lipodystrophy refers to abnormalities in fat distribution and metabolism occurring in some people living with HIV.

These abnormalities may include excess visceral fat, altered subcutaneous fat distribution and metabolic disturbances.

Clinical Research Areas

Abdominal visceral fat

Body composition

Lipid metabolism

Insulin resistance

Quality-of-life measurements

Long-term metabolic outcomes

Tesamorelin was developed and clinically evaluated for excess abdominal fat in this specific population.

Its approved indication is narrower than general obesity treatment.

Tesamorelin Clinical Research in HIV-Associated Visceral Adiposity

Randomized, placebo-controlled studies evaluated tesamorelin in adults with HIV-associated excess abdominal fat.

The clinical development program demonstrated reductions in visceral adipose tissue compared with placebo.

In pivotal studies, average visceral fat reductions were approximately 15–18% over 26 weeks, depending on the study and analysis.

Important Findings

Reduced visceral adipose tissue

Changes in abdominal fat distribution

Increased IGF-1

Variable effects on metabolic biomarkers

Important Limitations

Tesamorelin is not indicated for general weight loss management.

The FDA labeling describes it as having a weight-neutral effect.

Furthermore, visceral fat can return after treatment discontinuation.

Long-term cardiovascular outcome benefits have not been established.

Tesamorelin and Body Composition Research

Body composition includes fat mass, lean mass and other tissue compartments.

Tesamorelin has been investigated for effects on abdominal fat distribution.

Research Areas

Visceral fat

Subcutaneous fat

Trunk fat

Lean mass

Waist circumference

Metabolic measurements

Body weight

A reduction in visceral fat should not be confused with a generalized reduction in total body weight.

Changes in body composition can occur without substantial changes in overall body weight.

Tesamorelin and Lipid Metabolism

Growth hormone influences lipid metabolism.

Tesamorelin's effects on the GH–IGF-1 axis have made it relevant to research involving adipose tissue metabolism.

Research Topics

Lipolysis-associated pathways

Visceral fat distribution

Triglycerides

Lipoprotein metabolism

Hepatic lipid accumulation

Metabolic signaling

Body composition

However, improvements in one lipid-related endpoint do not establish universal cardiometabolic benefit.

Tesamorelin and Liver Fat Research

Excess liver fat is associated with metabolic dysfunction.

Tesamorelin has been investigated in adults living with HIV who also have hepatic steatosis.

A randomized, double-blind study published in The Lancet HIV in 2019 evaluated tesamorelin in 61 participants with HIV and nonalcoholic fatty liver disease, using the terminology current at the time.

The study assessed changes in hepatic fat over 12 months.

Principal Findings

Tesamorelin significantly reduced hepatic fat compared with placebo.

Approximately 35% of tesamorelin-treated participants achieved a hepatic fat fraction below 5%, compared with approximately 4% of placebo-treated participants.

The study also investigated liver histology and fibrosis progression.

Scientific Interpretation

These findings support continued research into the metabolic effects of GHRH analogues in specific populations.

However, tesamorelin is not established as a general treatment for MASLD or MASH.

The trial's results cannot automatically be generalized to people without HIV.

Tesamorelin and MASLD Research

Metabolic dysfunction-associated steatotic liver disease, or MASLD, is characterized by hepatic steatosis associated with cardiometabolic risk factors.

Earlier clinical literature often used the term NAFLD.

Research Areas

Hepatic fat fraction

Liver enzymes

Insulin resistance

Visceral adiposity

Liver inflammation

Fibrosis-associated markers

Metabolic biomarkers

Tesamorelin's effects on liver fat have been investigated in HIV-associated hepatic steatosis.

However, an approved indication for MASLD has not been established.

Tesamorelin and Liver Fibrosis Research

Liver fibrosis involves accumulation of extracellular matrix following chronic liver injury.

Tesamorelin has been investigated for its effects on liver-related endpoints in people with HIV-associated hepatic steatosis.

Research Areas

Fibrosis progression

Histological liver changes

Liver fat

Inflammation markers

Metabolic risk factors

GH–IGF-1 signaling

Some analyses have suggested favorable effects on fibrosis progression in the studied population.

However, the available evidence does not establish tesamorelin as a broadly effective antifibrotic treatment.

Larger and longer clinical studies are required to determine effects on important liver outcomes.

Tesamorelin and Glucose Metabolism

Growth hormone can influence glucose metabolism and insulin sensitivity.

Tesamorelin stimulates endogenous GH secretion and increases IGF-1.

These endocrine effects require careful evaluation.

Research Endpoints

Fasting glucose

Insulin sensitivity

HbA1c

Glucose tolerance

Insulin secretion

GH concentrations

IGF-1 concentrations

Important Safety Consideration

Tesamorelin can cause glucose intolerance and may increase the risk of developing diabetes.

The FDA-approved product labeling includes warnings regarding glucose intolerance and diabetes.

Therefore, tesamorelin should not be characterized as universally improving glucose regulation.

Tesamorelin and Insulin Resistance

Insulin resistance is influenced by multiple physiological factors.

These include adipose tissue distribution, hepatic metabolism, skeletal muscle physiology and endocrine signaling.

Tesamorelin's effects on visceral adiposity may influence metabolic measurements.

However, GH itself can have insulin-antagonistic effects.

Research Questions

How does visceral fat reduction affect insulin sensitivity?

What is the contribution of GH secretion?

How do IGF-1 changes influence metabolic responses?

Are effects different in people with and without diabetes?

What happens after treatment discontinuation?

The balance between these mechanisms remains important to clinical research.

Tesamorelin and Cardiometabolic Research

Cardiometabolic health involves interactions among adiposity, glucose metabolism, blood pressure and lipid regulation.

Tesamorelin studies have measured several cardiometabolic endpoints.

Research Areas

Visceral adipose tissue

Lipid profiles

Glucose tolerance

Insulin resistance

Inflammatory biomarkers

Body composition

Cardiovascular risk markers

However, reductions in visceral fat do not establish that tesamorelin prevents heart attacks, strokes or cardiovascular death.

The long-term cardiovascular safety of approved tesamorelin formulations has not been established.

Tesamorelin and Aging Research

Growth hormone secretion and GH–IGF-1 signaling change with age.

These changes have generated research interest in GHRH analogues.

Experimental Research Areas

Age-associated GH secretion

Somatotroph responsiveness

IGF-1 regulation

Body composition

Endocrine feedback

Metabolic aging

However, tesamorelin has not been established as an anti-aging treatment.

There is insufficient evidence that tesamorelin reverses biological aging or extends human lifespan.

Increasing GH or IGF-1 is not inherently beneficial and may introduce risks.

Tesamorelin and Muscle Research

Growth hormone and IGF-1 participate in muscle-related physiology.

Tesamorelin can influence the GH–IGF-1 axis.

However, this does not establish clinically meaningful muscle-building effects in healthy individuals.

Research Areas

GH signaling

IGF-1 responses

Protein metabolism

Lean mass

Body composition

Muscle-associated endocrine physiology

Tesamorelin is not approved for bodybuilding, athletic performance or muscle hypertrophy.

Tesamorelin and Exercise Performance

Exercise performance depends on cardiovascular fitness, muscle function, training and metabolic adaptation.

Tesamorelin has not been established as an effective or safe performance-enhancing treatment.

Important Distinction

An increase in growth hormone secretion is not equivalent to a demonstrated improvement in athletic performance.

Controlled clinical evidence supporting tesamorelin for sports performance is inadequate.

Tesamorelin vs. Sermorelin

Tesamorelin and Sermorelin are both GHRH-related peptides.

However, they differ substantially in molecular structure.

Although both activate GHRHR, their molecular structures and clinical evidence differ.

Results involving tesamorelin should not automatically be attributed to sermorelin.

Tesamorelin vs. CJC-1295

CJC-1295 is a modified GHRH analogue investigated for prolonged growth hormone-releasing activity.

Tesamorelin is a different modified GHRH analogue.

Tesamorelin

44-amino-acid GHRH analogue

N-terminal trans-3-hexenoyl modification

GHRHR activation

Specific FDA-approved pharmaceutical formulations

CJC-1295

Modified GHRH-derived peptide

GHRHR activation

Different molecular modifications

No FDA-approved CJC-1295 medicine

CJC-1295 variants may also differ depending on whether they contain a drug-affinity complex component.

The compounds are not interchangeable.

Tesamorelin vs. Ipamorelin

Ipamorelin is a growth hormone secretagogue receptor agonist.

Its primary receptor is GHSR1a, which differs from GHRHR.

Both can influence GH secretion through different upstream receptors.

Tesamorelin vs. Recombinant Human Growth Hormone

Tesamorelin and recombinant human growth hormone are pharmacologically distinct.

Tesamorelin

Activates GHRHR and stimulates endogenous GH secretion.

Recombinant HGH

Acts directly as exogenous growth hormone.

Their clinical indications, pharmacology and safety considerations differ.

Tesamorelin vs. GLP-1 Receptor Agonists

Tesamorelin and GLP-1 receptor agonists target different endocrine pathways.

Tesamorelin

GHRHR activation

GH–IGF-1 signaling

Visceral adipose tissue research

GLP-1 Receptor Agonists

GLP-1R activation

Appetite-related signaling

Glucose-dependent insulin secretion

Weight-management and diabetes research

Tesamorelin is not a GLP-1 receptor agonist.

It should not be described as a direct substitute for semaglutide or tirzepatide.

Tesamorelin Safety Considerations

The safety profile of approved tesamorelin formulations has been evaluated in clinical trials.

However, the safety of research-grade tesamorelin cannot be assumed from those studies.

Important Risks and Warnings

Elevated IGF-1

Tesamorelin can increase circulating IGF-1 concentrations.

Glucose Intolerance and Diabetes

Changes in glucose metabolism may occur.

Fluid Retention

GH-associated fluid retention can contribute to edema and musculoskeletal symptoms.

Hypersensitivity

Serious hypersensitivity reactions have been reported.

Injection-Site Reactions

These have occurred in clinical studies of approved formulations.

Active Malignancy

Approved tesamorelin products are contraindicated in patients with active malignancy.

Hypothalamic–Pituitary Axis Disruption

Certain disorders affecting the hypothalamic–pituitary axis are contraindications.

Pregnancy

Tesamorelin is contraindicated during pregnancy.

Long-Term Cardiovascular Safety

Long-term cardiovascular safety has not been established.

Research-Grade Product Limitations

The quality, sterility, impurity profile and clinical suitability of a research preparation cannot be inferred from the approved pharmaceutical product.

Tesamorelin and IGF-1-Related Safety

IGF-1 is a growth-related signaling molecule.

Tesamorelin increases IGF-1 through stimulation of endogenous GH secretion.

Research Considerations

IGF-1 concentrations

GH secretion

Feedback regulation

Tissue growth signaling

Metabolic effects

Long-term safety

Sustained elevation of IGF-1 requires clinical monitoring in patients receiving approved tesamorelin medicines.

Research-grade products are not appropriate substitutes for medically supervised treatment.

Tesamorelin Regulatory Status

United States

Tesamorelin is the active ingredient in FDA-approved prescription products.

EGRIFTA SV

A prescription tesamorelin formulation indicated for the reduction of excess abdominal fat in HIV-infected adults with lipodystrophy.

EGRIFTA WR

A newer prescription tesamorelin formulation with the same specific indication.

The FDA labeling explicitly states that EGRIFTA WR is not indicated for weight loss management.

The formulations have product-specific prescribing instructions and are not automatically interchangeable.

Research Products

Research-grade tesamorelin is not equivalent to an FDA-approved prescription medicine.

The approval of EGRIFTA products does not authorize other tesamorelin preparations for human administration.

Other Jurisdictions

FDA authorization does not automatically establish marketing approval in the European Union or other jurisdictions.

Regulatory status must be evaluated separately for each market and product.

Tesamorelin and Peptide Stability

Tesamorelin is a modified peptide.

Its chemical stability can be influenced by environmental and formulation conditions.

Research Areas

Hydrolysis

Oxidation

Deamidation

Aggregation

Adsorption

Temperature-associated degradation

pH-dependent changes

Impurity formation

Peptide content

Validated stability data are required for product-specific laboratory storage specifications.

Tesamorelin Analytical Characterization

Accurate identification is essential for reliable peptide research.

Tesamorelin's N-terminal modification and 44-amino-acid structure distinguish it from other GHRH analogues.

Important Quality Parameters

Verified amino acid sequence

N-terminal modification identity

C-terminal amidation

Molecular mass

Peptide purity

Peptide content

Counterion composition

Residual reagents

Related peptide impurities

Degradation products

Batch-specific documentation

High-Performance Liquid Chromatography

HPLC can be used to evaluate tesamorelin purity.

Relevant measurements include:

Chromatographic purity

Related substances

Degradation products

Batch consistency

Method specificity

HPLC purity alone does not establish pharmaceutical quality or clinical suitability.

Liquid Chromatography–Mass Spectrometry

LC-MS can help verify tesamorelin molecular identity.

For the defined tesamorelin molecular entity, the expected average molecular weight is approximately 5,136 g/mol.

Mass spectrometry should be interpreted alongside sequence and modification information.

Different salt forms can have different total chemical compositions.

Certificate of Analysis

A batch-specific Certificate of Analysis should include:

• Product identity

• Batch or lot number

• Molecular formula

• Molecular mass

• Amino acid sequence

• N-terminal modification

• C-terminal modification

• Peptide purity

• Peptide content

• Counterion information

• Analytical methods

• Impurity profile

• Stability information

A COA does not establish clinical efficacy, sterility or suitability for human administration.

Scientific Evidence and Research Limitations

Established Scientific Facts

• Tesamorelin is a modified 44-amino-acid GHRH analogue.

• Its development code is TH9507.

• It activates GHRHR.

• GHRHR activation stimulates endogenous GH secretion.

• Tesamorelin can increase circulating IGF-1.

• Clinical studies have demonstrated reductions in visceral adipose tissue in adults with HIV-associated lipodystrophy.

• Tesamorelin is the active ingredient in FDA-approved prescription products for a specific indication.

• EGRIFTA products are not indicated for general weight management.

• Clinical research has investigated tesamorelin's effects on hepatic fat in people living with HIV.

• Tesamorelin has clinically relevant safety warnings.

Important Limitations

• Tesamorelin is not a general anti-obesity medicine.

• It is not established as an anti-aging treatment.

• Muscle-building benefits in healthy individuals are unproven.

• Athletic performance benefits are unproven.

• Long-term cardiovascular benefits have not been established.

• Liver fat findings cannot be generalized to every MASLD population.

• Elevated IGF-1 may present safety concerns.

• Glucose intolerance and diabetes are relevant risks.

• Clinical evidence for EGRIFTA does not establish the safety of research-grade tesamorelin.

• ICAME Pharmacy Tesamorelin is not an FDA-approved pharmaceutical formulation.

Potential Tesamorelin Research Applications

Tesamorelin may be relevant to appropriately controlled laboratory investigations involving:

• GHRH receptor pharmacology

• Class B GPCR signaling

• Gs protein activation

• Adenylyl cyclase activity

• cAMP signaling

• PKA signaling

• Pituitary somatotroph biology

• Growth hormone secretion

• GH–IGF-1 axis regulation

• Endocrine feedback

• Visceral adipose tissue

• Lipid metabolism

• Body composition

• HIV-associated lipodystrophy biology

• Hepatic lipid accumulation

• Glucose metabolism

• Insulin resistance

• Metabolic inflammation

• GHRH analogue structure–activity relationships

• Peptide stability

• Peptide analytical characterization

These research areas do not establish therapeutic benefits for ICAME Pharmacy research products.

Tesamorelin Research Overview

Compound Name: Tesamorelin

Development Code: TH9507

Classification: Synthetic GHRH Analogue

Peptide Length: 44 Amino Acids

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

N-Terminal Modification: trans-3-Hexenoyl

C-Terminal Modification: Amidation

Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S

Molecular Weight: Approximately 5,136 g/mol

CAS Number: 218949-48-5

PubChem CID: 16137828

Primary Receptor: GHRHR

Principal Signaling: Gs–cAMP–PKA

Downstream Endocrine Axis: GH–IGF-1

Research Areas: Endocrine Biology / Visceral Fat / Lipid Metabolism / Hepatic Fat Research

FDA Status: Approved Active Ingredient in Specific Prescription Formulations

ICAME Product Status: Research Use Only

ICAME Pharmacy Product Information

Product Name: Tesamorelin

Alternative Name: TH9507

Brand: ICAME Pharmacy

Product Category: Research Peptide

Research Classification: Growth Hormone-Releasing Hormone Analogue

Research Areas: GHRHR Signaling / GH–IGF-1 Axis / Visceral Adipose Tissue / Metabolic Biology

Intended Use: Laboratory Research & Development Only

Product specifications should be verified using batch-specific analytical documentation.

Relevant quality information includes:

• Verified molecular identity

• Complete peptide sequence

• Molecular mass

• N-terminal modification

• C-terminal amidation

• Peptide purity

• Peptide content

• Counterion composition

• Impurity profile

• Certificate of Analysis

• Batch identification

• Validated stability information

No claims of pharmaceutical equivalence, sterility, injectable suitability or clinical efficacy should be made without appropriate supporting documentation and regulatory authorization.

Important Research Use Notice

FOR RESEARCH USE ONLY (RUO)

This ICAME Pharmacy product is intended exclusively for legitimate laboratory, analytical and scientific research purposes.

Not for human or veterinary use. Not for diagnostic, therapeutic, weight-loss, bodybuilding, anti-aging, athletic performance enhancement or other clinical purposes. Not for direct administration to humans or animals.

Tesamorelin is a synthetic GHRH analogue investigated in endocrine and metabolic research.

FDA-approved tesamorelin prescription medicines exist for the reduction of excess abdominal fat in adults with HIV-associated lipodystrophy.

ICAME Pharmacy Tesamorelin is not EGRIFTA SV or EGRIFTA WR and is not an FDA-approved pharmaceutical product.

Clinical evidence supporting approved prescription formulations does not establish the safety, efficacy or suitability of research-grade tesamorelin for human administration.

Information on this page is intended solely for scientific and educational purposes and does not constitute medical advice, prescribing information, dosage guidance or instructions for human use.

About ICAME Pharmacy

ICAME Pharmacy provides specialized research products for professional laboratory and scientific applications.

Our portfolio focuses on compounds relevant to peptide science, endocrinology, receptor pharmacology, metabolic signaling, molecular biology and analytical chemistry.

We emphasize accurate product identification, responsible research use, scientific transparency and clear communication of evidence limitations.

For batch-specific analytical documentation and product inquiries, please contact ICAME Pharmacy.

Frequently Asked Questions About Tesamorelin

What is Tesamorelin?

Tesamorelin is a synthetic 44-amino-acid analogue of growth hormone-releasing hormone.

What is another name for Tesamorelin?

TH9507.

How many amino acids does Tesamorelin contain?

44 amino acids.

What is the molecular formula of Tesamorelin?

C₂₂₁H₃₆₆N₇₂O₆₇S.

What is the molecular weight of Tesamorelin?

Approximately 5,136 g/mol.

What is the CAS number of Tesamorelin?

218949-48-5.

What is the PubChem CID of Tesamorelin?

What receptor does Tesamorelin activate?

The growth hormone-releasing hormone receptor, GHRHR.

How does Tesamorelin work?

Tesamorelin activates GHRHR and stimulates endogenous GH secretion through Gs–cAMP-associated signaling.

Does Tesamorelin increase IGF-1?

Yes. Tesamorelin can increase circulating IGF-1 through the GH–IGF-1 axis.

Is Tesamorelin the same as growth hormone?

No. Tesamorelin stimulates endogenous GH secretion rather than directly replacing GH.

Is Tesamorelin the same as Sermorelin?

No. Tesamorelin is a modified 44-amino-acid peptide, while Sermorelin contains 29 amino acids.

Is Tesamorelin the same as CJC-1295?

No. They are distinct modified GHRH analogues.

Is Tesamorelin the same as Ipamorelin?

No. Ipamorelin primarily activates the ghrelin receptor GHSR1a.

Does Tesamorelin reduce visceral fat?

Clinical studies have demonstrated reductions in visceral adipose tissue in adults with HIV-associated lipodystrophy.

Is Tesamorelin a weight-loss drug?

No. FDA-approved tesamorelin products are not indicated for general weight management.

Does Tesamorelin reduce liver fat?

A randomized clinical study reported reduced hepatic fat in adults living with HIV and hepatic steatosis.

Does Tesamorelin treat MASLD?

It is not an established or FDA-approved treatment for MASLD.

Does Tesamorelin build muscle?

Clinically meaningful muscle-building benefits in healthy individuals have not been established.

Does Tesamorelin reverse aging?

No. Human anti-aging or lifespan-extension benefits have not been established.

Is Tesamorelin FDA-approved?

Yes, tesamorelin is the active ingredient in FDA-approved prescription products for a specific HIV-associated lipodystrophy indication.

What are EGRIFTA SV and EGRIFTA WR?

They are FDA-approved prescription tesamorelin formulations.

Is research-grade Tesamorelin the same as EGRIFTA?

No. Research-grade tesamorelin is not equivalent to the approved pharmaceutical products.

Can Tesamorelin affect glucose metabolism?

Yes. Glucose intolerance and diabetes are important safety considerations.

Can Tesamorelin increase IGF-1?

Yes. Elevated IGF-1 is a recognized pharmacodynamic effect and safety-monitoring consideration.

Is Tesamorelin safe for human use?

Approved prescription formulations have defined indications, contraindications and safety warnings. Research-grade tesamorelin has not been established as suitable for human administration.

Is ICAME Pharmacy Tesamorelin intended for human use?

No. ICAME Pharmacy Tesamorelin is intended strictly for laboratory research and development purposes.